(data stored in ACNUC7421 zone)

EMBL: CP000769.PE119

CP000769.PE119       Location/Qualifiers
FT   CDS             complement(149805..150236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0121"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: ade:Adeh_0117
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24339"
FT                   /db_xref="GOA:A7H6J3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J3"
FT                   /protein_id="ABS24339.1"
FT                   /translation="MARPDMGGPKSSGGFGGPRSGGGFGGGGYGGGGGGGGGYGGGGGG
FT                   GFGGRGGDRGDRGDRDDRGGEEGGRRGFGRRKVCRFCADKTLKVDYKDQSQMKYFLTER
FT                   GKIIPRRISGNCAKHQREVATAVKRGRMLAILPYTVGGM"
     MARPDMGGPK SSGGFGGPRS GGGFGGGGYG GGGGGGGGYG GGGGGGFGGR GGDRGDRGDR        60
     DDRGGEEGGR RGFGRRKVCR FCADKTLKVD YKDQSQMKYF LTERGKIIPR RISGNCAKHQ       120
     REVATAVKRG RMLAILPYTV GGM                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page