(data stored in ACNUC7421 zone)

EMBL: CP000769.PE120

CP000769.PE120       Location/Qualifiers
FT   CDS             complement(150240..150692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0122"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: ade:Adeh_0118
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24340"
FT                   /db_xref="GOA:A7H6J4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J4"
FT                   /protein_id="ABS24340.1"
FT                   /translation="MAETRKLVREYETIYLLKAETPDDQVEEIKERLRGVVTREGGKVI
FT                   RFTNQGKRKTAFPVGKNPKALYMHCLYIGQPGLVAELERNLKMIDQVSKFQSVRLAEGV
FT                   DFDARQVEPDVKIQAVEDEPKPREERGEFAPGDEPFEAEAPEAAEE"
     MAETRKLVRE YETIYLLKAE TPDDQVEEIK ERLRGVVTRE GGKVIRFTNQ GKRKTAFPVG        60
     KNPKALYMHC LYIGQPGLVA ELERNLKMID QVSKFQSVRL AEGVDFDARQ VEPDVKIQAV       120
     EDEPKPREER GEFAPGDEPF EAEAPEAAEE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page