(data stored in ACNUC7421 zone)

EMBL: CP000769.PE122

CP000769.PE122       Location/Qualifiers
FT   CDS             complement(151386..152093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0124"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   ade:Adeh_0120 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24342"
FT                   /db_xref="GOA:A7H6J6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J6"
FT                   /protein_id="ABS24342.1"
FT                   /translation="MADNIINAQRREEKGKGPARRLRQKGLIPAVVYGRKQEPTHLSVD
FT                   PASLLKAIETPHKFNTLLTLKLDGAEKHVLFKDWAVDPVSRKLEHADFLEVKLDEAVKV
FT                   AVPVVTSGRSVGQAEGGILSLATHEVVLEALPSKIPVRIEVDVTNLKIGQSIHVSQLTP
FT                   PEGCKLKYSSDYVIAFVAVPEKEEVAAPVAAAVPGAAPAEGAAAAGAPAAGAAPAAGGE
FT                   AAKKAPEAKGAKK"
     MADNIINAQR REEKGKGPAR RLRQKGLIPA VVYGRKQEPT HLSVDPASLL KAIETPHKFN        60
     TLLTLKLDGA EKHVLFKDWA VDPVSRKLEH ADFLEVKLDE AVKVAVPVVT SGRSVGQAEG       120
     GILSLATHEV VLEALPSKIP VRIEVDVTNL KIGQSIHVSQ LTPPEGCKLK YSSDYVIAFV       180
     AVPEKEEVAA PVAAAVPGAA PAEGAAAAGA PAAGAAPAAG GEAAKKAPEA KGAKK            235
//

If you have problems or comments...

PBIL Back to PBIL home page