(data stored in ACNUC7421 zone)

EMBL: CP000769.PE124

CP000769.PE124       Location/Qualifiers
FT   CDS             complement(153383..153676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0126"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: ade:Adeh_0122
FT                   SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24344"
FT                   /db_xref="GOA:A7H6J8"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J8"
FT                   /protein_id="ABS24344.1"
FT                   /translation="MEITEVRVFPVNEEKLKAYVTITLDDCFVVRDLKVIHGNTGLFIA
FT                   MPAKRRKDGTFKDIAHPLNTETRERMERTILAEYDRELRKGAAPRPTGTHDD"
     MEITEVRVFP VNEEKLKAYV TITLDDCFVV RDLKVIHGNT GLFIAMPAKR RKDGTFKDIA        60
     HPLNTETRER MERTILAEYD RELRKGAAPR PTGTHDD                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page