(data stored in ACNUC7421 zone)

EMBL: CP000769.PE125

CP000769.PE125       Location/Qualifiers
FT   CDS             complement(153628..154545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0127"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ade:Adeh_0123
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24345"
FT                   /db_xref="GOA:A7H6J9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J9"
FT                   /protein_id="ABS24345.1"
FT                   /translation="MRLQTIAPAKVNLVLRVGPPRRDGYHGIRSLMVPLDLGDRVDVSV
FT                   GERAGPVTCRVPGRPELDGADNLAARAAERFRARFGVERTIGIRIAKRIPVTAGLGGGS
FT                   SDAAAVLRCLARAFGIRDRAALAAIALEVGSDVPFFLGPGPAWAEGRGERLTPADVPPQ
FT                   HLVLVYPDDPALAIRAGEAYRWLDASRQGRRPRLPPRFARFEPSRAGNDLQPPCLLERP
FT                   PLATLLGLLVGRGATAAIMSGSGPTVFGTFHSRNAAARAARTIAEEVVDRKVMVLAATT
FT                   VRRHPGVTPWRSPRSASSPSTKRS"
     MRLQTIAPAK VNLVLRVGPP RRDGYHGIRS LMVPLDLGDR VDVSVGERAG PVTCRVPGRP        60
     ELDGADNLAA RAAERFRARF GVERTIGIRI AKRIPVTAGL GGGSSDAAAV LRCLARAFGI       120
     RDRAALAAIA LEVGSDVPFF LGPGPAWAEG RGERLTPADV PPQHLVLVYP DDPALAIRAG       180
     EAYRWLDASR QGRRPRLPPR FARFEPSRAG NDLQPPCLLE RPPLATLLGL LVGRGATAAI       240
     MSGSGPTVFG TFHSRNAAAR AARTIAEEVV DRKVMVLAAT TVRRHPGVTP WRSPRSASSP       300
     STKRS                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page