(data stored in ACNUC7421 zone)

EMBL: CP000769.PE126

CP000769.PE126       Location/Qualifiers
FT   CDS             154700..155119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24346"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K0"
FT                   /protein_id="ABS24346.1"
FT                   /translation="MSRLFARLSVPCLAALAVAASGCASAFGPEPVTRLSEAPQAQLSA
FT                   TVKQEVALRTGPDKLAHVVERLPAGASVTASDRAVRGYRRVRTEAGRTGYVEESALEVG
FT                   AAVAAPATPAAPAPAPADGAPAAAAPEAAGQPVAN"
     MSRLFARLSV PCLAALAVAA SGCASAFGPE PVTRLSEAPQ AQLSATVKQE VALRTGPDKL        60
     AHVVERLPAG ASVTASDRAV RGYRRVRTEA GRTGYVEESA LEVGAAVAAP ATPAAPAPAP       120
     ADGAPAAAAP EAAGQPVAN                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page