(data stored in ACNUC7421 zone)

EMBL: CP000769.PE130

CP000769.PE130       Location/Qualifiers
FT   CDS             158374..159159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24350"
FT                   /db_xref="GOA:A7H6K4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K4"
FT                   /protein_id="ABS24350.1"
FT                   /translation="MADDTTRAPRRGGGARAAVAWLAILALLGVVVWLVSERNARTWYL
FT                   VPDEGRLVVMRGVLAPIGRQTFKTADPVLAQAYEPIVAPPGKPLPEARGFEERSLLDQG
FT                   IYEIVSGWARDEIASGDPARLERGLGYLSRAERLAGLSAAQREDLSALRAESGFYEAQR
FT                   LLDRAVGELRQAAEKLRHTAASRSAHANDARALLHDVEPALDAAAVALRSAGGAPRPRT
FT                   GPPQPAQESQPAPQGATPAEPAPPAPAPAAPETGAAGER"
     MADDTTRAPR RGGGARAAVA WLAILALLGV VVWLVSERNA RTWYLVPDEG RLVVMRGVLA        60
     PIGRQTFKTA DPVLAQAYEP IVAPPGKPLP EARGFEERSL LDQGIYEIVS GWARDEIASG       120
     DPARLERGLG YLSRAERLAG LSAAQREDLS ALRAESGFYE AQRLLDRAVG ELRQAAEKLR       180
     HTAASRSAHA NDARALLHDV EPALDAAAVA LRSAGGAPRP RTGPPQPAQE SQPAPQGATP       240
     AEPAPPAPAP AAPETGAAGE R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page