(data stored in ACNUC7421 zone)

EMBL: CP000769.PE132

CP000769.PE132       Location/Qualifiers
FT   CDS             161999..162541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0134"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ade:Adeh_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24352"
FT                   /db_xref="GOA:A7H6K6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K6"
FT                   /protein_id="ABS24352.1"
FT                   /translation="MSVPRRYERIDIELPCRLFIPGEVGLRFEAFCTSQNLGLGGLFVT
FT                   SSFLLRAGLELYVELALPDGPLAIRSRIAHVVPHGDRAHPTGMGIEFLDVDAHGRETLL
FT                   RYFTPARYTSFYEAFIAEFPHLDETVPLRDVSLVLNLWEEWKIRGEGGPLSTASGAPPA
FT                   PALGEGTTDARGVRSRR"
     MSVPRRYERI DIELPCRLFI PGEVGLRFEA FCTSQNLGLG GLFVTSSFLL RAGLELYVEL        60
     ALPDGPLAIR SRIAHVVPHG DRAHPTGMGI EFLDVDAHGR ETLLRYFTPA RYTSFYEAFI       120
     AEFPHLDETV PLRDVSLVLN LWEEWKIRGE GGPLSTASGA PPAPALGEGT TDARGVRSRR       180
//

If you have problems or comments...

PBIL Back to PBIL home page