(data stored in ACNUC7421 zone)

EMBL: CP000769.PE137

CP000769.PE137       Location/Qualifiers
FT   CDS             167889..169316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0139"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: ade:Adeh_0135
FT                   glycogen/starch synthase, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24357"
FT                   /db_xref="GOA:A7H6L1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6L1"
FT                   /protein_id="ABS24357.1"
FT                   /translation="MEILFVASEVAPWSKTGGLGDVAGALPRALAARGHAVSVVTPRYG
FT                   TIDPHAHRLRPLHRALDVRGEPTTLWVSRDRAPVYFVEHEHFFGSRRGLYGEAHDYGDN
FT                   AERFAYLARAALALPGALGLRPHIVHLNDWQTGLVPFLLRREHARDAALAGARTVFTIH
FT                   NLAYQGVFSKHVVPALGLPWDVFRYEAMEFHDQLNFLKAGLVFADALTTVSPTYAREIA
FT                   TPQGGVGLDALLRHRARDLHGILNGIDVEEWDPATDRHLPARYSAADLSGKAACKSALQ
FT                   RELGLPERPDVPLVAMIGRLAEQKGLDLVVAALGELLARDLQLVLLGTGRPELEEAFRR
FT                   AARERPDRMAARIGFDEGLAHRMEAGADLFLMPSRFEPCGLNQMYSLRYGTIPVVRAVG
FT                   GLEDTVEDFDGWSRGTGFKFRDYHPQAMLLAVRRALEAHRDRRAWRAMMLRGMALDFSW
FT                   DRSAQAYEALYRSLAAP"
     MEILFVASEV APWSKTGGLG DVAGALPRAL AARGHAVSVV TPRYGTIDPH AHRLRPLHRA        60
     LDVRGEPTTL WVSRDRAPVY FVEHEHFFGS RRGLYGEAHD YGDNAERFAY LARAALALPG       120
     ALGLRPHIVH LNDWQTGLVP FLLRREHARD AALAGARTVF TIHNLAYQGV FSKHVVPALG       180
     LPWDVFRYEA MEFHDQLNFL KAGLVFADAL TTVSPTYARE IATPQGGVGL DALLRHRARD       240
     LHGILNGIDV EEWDPATDRH LPARYSAADL SGKAACKSAL QRELGLPERP DVPLVAMIGR       300
     LAEQKGLDLV VAALGELLAR DLQLVLLGTG RPELEEAFRR AARERPDRMA ARIGFDEGLA       360
     HRMEAGADLF LMPSRFEPCG LNQMYSLRYG TIPVVRAVGG LEDTVEDFDG WSRGTGFKFR       420
     DYHPQAMLLA VRRALEAHRD RRAWRAMMLR GMALDFSWDR SAQAYEALYR SLAAP            475
//

If you have problems or comments...

PBIL Back to PBIL home page