(data stored in ACNUC7421 zone)

EMBL: CP000769.PE138

CP000769.PE138       Location/Qualifiers
FT   CDS             169370..169651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24358"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L2"
FT                   /protein_id="ABS24358.1"
FT                   /translation="MGPRFDDEPDPPEPTVQPSDRTHRERMAEADEKVVPIENVGGAAP
FT                   TPLGLDSGGNFPGSEDDLSNLPEPEPPEPPEVGAVHVREDERGRRRRR"
     MGPRFDDEPD PPEPTVQPSD RTHRERMAEA DEKVVPIENV GGAAPTPLGL DSGGNFPGSE        60
     DDLSNLPEPE PPEPPEVGAV HVREDERGRR RRR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page