(data stored in ACNUC7421 zone)

EMBL: CP000769.PE147

CP000769.PE147       Location/Qualifiers
FT   CDS             complement(177566..177946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0149"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0144 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24367"
FT                   /db_xref="GOA:A7H6M1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M1"
FT                   /protein_id="ABS24367.1"
FT                   /translation="MMPGQYILVVDDDDDFREALSEVLVEAGYPVQKAENGEVALARVS
FT                   DEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAVPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPLRH"
     MMPGQYILVV DDDDDFREAL SEVLVEAGYP VQKAENGEVA LARVSDEAPG IVLLDLKMPV        60
     LDGWGVMERM RGDAKSAAVP ILILSAYGFE WEAELLGAQG YIPKSVGMDE ILERVRKAAG       120
     PPPLRH                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page