(data stored in ACNUC7421 zone)

EMBL: CP000769.PE149

CP000769.PE149       Location/Qualifiers
FT   CDS             179203..180168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0151"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: ade:Adeh_0146 HPr
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24369"
FT                   /db_xref="GOA:A7H6M3"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M3"
FT                   /protein_id="ABS24369.1"
FT                   /translation="MDAIRVGALLDDKKFDLRLSLVAGKQGLSRRISSARIQKPGLVLA
FT                   GFTENLHRERVQVFGNTEMSYLATLPRERAVDVLRSFFSADVACLVVTKGLDVPPEMAA
FT                   AADESGVPLLRTTHLSSTFIEGVQNYLEDILTAQTSMHGVLLDVFGVGILLLGKSGIGK
FT                   SEIALDLIMRGHRLVADDIVDVKRRTPDSVYGAGSEIIKHHMEIRGLGIINIKDLFGVA
FT                   SIRERKKIEIVLELVEWDPSVEYDRLGVEEKKFRILDVEIPMLIVPVRPGRNMTTIVEV
FT                   AARNHLLKLQGHHSAREFQERLNRAIALAPGGRVGELDVE"
     MDAIRVGALL DDKKFDLRLS LVAGKQGLSR RISSARIQKP GLVLAGFTEN LHRERVQVFG        60
     NTEMSYLATL PRERAVDVLR SFFSADVACL VVTKGLDVPP EMAAAADESG VPLLRTTHLS       120
     STFIEGVQNY LEDILTAQTS MHGVLLDVFG VGILLLGKSG IGKSEIALDL IMRGHRLVAD       180
     DIVDVKRRTP DSVYGAGSEI IKHHMEIRGL GIINIKDLFG VASIRERKKI EIVLELVEWD       240
     PSVEYDRLGV EEKKFRILDV EIPMLIVPVR PGRNMTTIVE VAARNHLLKL QGHHSAREFQ       300
     ERLNRAIALA PGGRVGELDV E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page