(data stored in ACNUC7421 zone)

EMBL: CP000769.PE153

CP000769.PE153       Location/Qualifiers
FT   CDS             182075..182779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24373"
FT                   /db_xref="GOA:A7H6M7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M7"
FT                   /protein_id="ABS24373.1"
FT                   /translation="MGLSYLVLGVVAGLAAVERKGFLQAMLSRPIALAPVTGWALGDPQ
FT                   GGLLVAPPLELLWLGAVNLGAALPVHEALATAAITGGAVLAGRALGAGVSPEVAILAVL
FT                   ICAPLALVGRRADRLVEGWNERIALRAEAALASGHPRAAVRWNLSGLAAPFAVAALVAP
FT                   AGAALAAVAIPAFLRAVPAAATPLQLGFFAFAALACASGAKALRAREAPRYFYGALAVA
FT                   LVAGVIVGRALS"
     MGLSYLVLGV VAGLAAVERK GFLQAMLSRP IALAPVTGWA LGDPQGGLLV APPLELLWLG        60
     AVNLGAALPV HEALATAAIT GGAVLAGRAL GAGVSPEVAI LAVLICAPLA LVGRRADRLV       120
     EGWNERIALR AEAALASGHP RAAVRWNLSG LAAPFAVAAL VAPAGAALAA VAIPAFLRAV       180
     PAAATPLQLG FFAFAALACA SGAKALRARE APRYFYGALA VALVAGVIVG RALS             234
//

If you have problems or comments...

PBIL Back to PBIL home page