(data stored in ACNUC7421 zone)

EMBL: CP000769.PE156

CP000769.PE156       Location/Qualifiers
FT   CDS             183817..185616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0158"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ade:Adeh_0153
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24376"
FT                   /db_xref="GOA:A7H6N0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N0"
FT                   /protein_id="ABS24376.1"
FT                   /translation="MTPSATSILVGIAASPGIAIGRCWPVDRRKVRAPKRLLAPEEIEN
FT                   ELARLRTALEISELQLAEVREKVERAPGTQGGAEHTAIIDMHRMMLKDEMLVLEAQRLI
FT                   REERVNAEWAVKRATRKIKSAFHEQADEYFKERRADVDYVGERVIKNLLGQAPDVEEPP
FT                   PEGAIIVAHDLSPADTALLLHERKVAAFVTDTGAKTSHTAIVARALEVPAVVGVGRITS
FT                   LAGRGDWIAVDGSRGVVVINPTPGERVEYEVARERFLEAEQVLLRTRDLPARTLDDVTV
FT                   RLAGNIEFVEEVPSLVAHGGEGVGLYRTEFLFIGRTELPGEGEQYQTYRRVLEALAPKP
FT                   VTIRTFDLGGEKLPVGMRLPAENPALGLRAIRYCLRQPEMFRAQLRALLRASVHGNLRI
FT                   MFPMISGVSELRAAKRLLAEVREELRREGAPVREEVPLGIMIELPSAALIADRLAEESD
FT                   FFSIGTNDLIQYAIGIDRQNKDVAYLYKPLHLAVLRMLKLICDAAQVKGIPVSMCGEMA
FT                   GDVMNTLVLIGLGVSELSMNGPAIPFVKRVVRAARAADGRALVERILSLTTADDIEREV
FT                   RTEMLRRFPELLEAEATFGPVSG"
     MTPSATSILV GIAASPGIAI GRCWPVDRRK VRAPKRLLAP EEIENELARL RTALEISELQ        60
     LAEVREKVER APGTQGGAEH TAIIDMHRMM LKDEMLVLEA QRLIREERVN AEWAVKRATR       120
     KIKSAFHEQA DEYFKERRAD VDYVGERVIK NLLGQAPDVE EPPPEGAIIV AHDLSPADTA       180
     LLLHERKVAA FVTDTGAKTS HTAIVARALE VPAVVGVGRI TSLAGRGDWI AVDGSRGVVV       240
     INPTPGERVE YEVARERFLE AEQVLLRTRD LPARTLDDVT VRLAGNIEFV EEVPSLVAHG       300
     GEGVGLYRTE FLFIGRTELP GEGEQYQTYR RVLEALAPKP VTIRTFDLGG EKLPVGMRLP       360
     AENPALGLRA IRYCLRQPEM FRAQLRALLR ASVHGNLRIM FPMISGVSEL RAAKRLLAEV       420
     REELRREGAP VREEVPLGIM IELPSAALIA DRLAEESDFF SIGTNDLIQY AIGIDRQNKD       480
     VAYLYKPLHL AVLRMLKLIC DAAQVKGIPV SMCGEMAGDV MNTLVLIGLG VSELSMNGPA       540
     IPFVKRVVRA ARAADGRALV ERILSLTTAD DIEREVRTEM LRRFPELLEA EATFGPVSG        599
//

If you have problems or comments...

PBIL Back to PBIL home page