(data stored in ACNUC7421 zone)

EMBL: CP000769.PE158

CP000769.PE158       Location/Qualifiers
FT   CDS             187079..188047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0160"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ade:Adeh_0155 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24378"
FT                   /db_xref="GOA:A7H6N2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N2"
FT                   /protein_id="ABS24378.1"
FT                   /translation="MTQPAPARPHGEALLGWMEGLADPTRLRLLHALERKELSVLELCE
FT                   VLALPQSTVSRHLKVLADQGWLASRRQGTQSLYGYADGLAPGARRLWLLARAESEAWPA
FT                   VRQDAERLQAVRARRDGAQRFFAGAAGAWDRLRAEVYGSSVAREALLALLPSSWTVADL
FT                   GCGTGALSAELAPHVREVVAVDQSAAMLRAARRRCAALPNVELHEARLEALPIADGRCD
FT                   AALLALVLAYLDEPAAALREAARVLAPGGRLVVLDAVRHSDEALRRRMGQVRPGFAPEE
FT                   LEALLAGAGLGAVRTRALPPEPGAKGPGLVVATAERASRRR"
     MTQPAPARPH GEALLGWMEG LADPTRLRLL HALERKELSV LELCEVLALP QSTVSRHLKV        60
     LADQGWLASR RQGTQSLYGY ADGLAPGARR LWLLARAESE AWPAVRQDAE RLQAVRARRD       120
     GAQRFFAGAA GAWDRLRAEV YGSSVAREAL LALLPSSWTV ADLGCGTGAL SAELAPHVRE       180
     VVAVDQSAAM LRAARRRCAA LPNVELHEAR LEALPIADGR CDAALLALVL AYLDEPAAAL       240
     REAARVLAPG GRLVVLDAVR HSDEALRRRM GQVRPGFAPE ELEALLAGAG LGAVRTRALP       300
     PEPGAKGPGL VVATAERASR RR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page