(data stored in ACNUC7421 zone)

EMBL: CP000769.PE159

CP000769.PE159       Location/Qualifiers
FT   CDS             188097..189578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0161"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; TrkA-N domain protein;
FT                   KEGG: ade:Adeh_0156 adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24379"
FT                   /db_xref="GOA:A7H6N3"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N3"
FT                   /protein_id="ABS24379.1"
FT                   /translation="MAVPAAKKKLLKPPAAPVEHRVKDLALAEWGRKEIELAEKEMPGL
FT                   MAVRREYARKRPLAGQRITGSLHMTVQTAVLIETLADLGADVRWASCNIFSTQDHAAAA
FT                   VVVGRGGTPDAPRGVPVFAWKGETLEEYWDCTERALDFGGGKGPTQIVDDGGDATLLIH
FT                   KGFEFEKAGKVPRAASADSEEYAVVLRLLGRELKKDPRRWTRVAEDCAGVTEETTTGVH
FT                   RLYEMQKAGTLLFPAINVNDSVTKSKFDNLYGCRHSLVDGLNRATDVMLAGKLCVVCGY
FT                   GDVGKGCAQALRGQGARVVVTEIDPINALQASMEGYQVVRVEDVVKEADVFVTATGNLD
FT                   VITVAHMQQMKDCAIVGNIGHFDNEIDIAGLKKVPGLEKVNIKPQYDAFVFPDGHRVLV
FT                   LAEGRLLNLGCATGHPSFVMSNSFTNQTLAQLELATNRAAYEKKVYVLPKHLDEKVAAL
FT                   HLEQIGAKLTKLTKKQAGYLGVPPNGPFKPDHYRY"
     MAVPAAKKKL LKPPAAPVEH RVKDLALAEW GRKEIELAEK EMPGLMAVRR EYARKRPLAG        60
     QRITGSLHMT VQTAVLIETL ADLGADVRWA SCNIFSTQDH AAAAVVVGRG GTPDAPRGVP       120
     VFAWKGETLE EYWDCTERAL DFGGGKGPTQ IVDDGGDATL LIHKGFEFEK AGKVPRAASA       180
     DSEEYAVVLR LLGRELKKDP RRWTRVAEDC AGVTEETTTG VHRLYEMQKA GTLLFPAINV       240
     NDSVTKSKFD NLYGCRHSLV DGLNRATDVM LAGKLCVVCG YGDVGKGCAQ ALRGQGARVV       300
     VTEIDPINAL QASMEGYQVV RVEDVVKEAD VFVTATGNLD VITVAHMQQM KDCAIVGNIG       360
     HFDNEIDIAG LKKVPGLEKV NIKPQYDAFV FPDGHRVLVL AEGRLLNLGC ATGHPSFVMS       420
     NSFTNQTLAQ LELATNRAAY EKKVYVLPKH LDEKVAALHL EQIGAKLTKL TKKQAGYLGV       480
     PPNGPFKPDH YRY                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page