(data stored in ACNUC7421 zone)

EMBL: CP000769.PE16

CP000769.PE16        Location/Qualifiers
FT   CDS             20330..21043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24236"
FT                   /db_xref="UniProtKB/TrEMBL:A7H690"
FT                   /protein_id="ABS24236.1"
FT                   /translation="MSLPKPPARPGAPLAKGALGAEDPLARSRRDKDELAESVKTLEEE
FT                   LEALKARYEQYFLGIERREPVRWREELKRNVARVKGAFTRNAALRFRIQTLNARYLSYE
FT                   RLWLRGAREREEGTYRRDLFKARLHARADEGRGQAADAAPAASAEAKPSATPAPRPTPA
FT                   PGGVDEAKLRALFDDYVAAKRRCNEDVSRLTYEAVARSVAKQVPDLMARFQAKSVDFRV
FT                   EVKDGRAVLKAIPKV"
     MSLPKPPARP GAPLAKGALG AEDPLARSRR DKDELAESVK TLEEELEALK ARYEQYFLGI        60
     ERREPVRWRE ELKRNVARVK GAFTRNAALR FRIQTLNARY LSYERLWLRG AREREEGTYR       120
     RDLFKARLHA RADEGRGQAA DAAPAASAEA KPSATPAPRP TPAPGGVDEA KLRALFDDYV       180
     AAKRRCNEDV SRLTYEAVAR SVAKQVPDLM ARFQAKSVDF RVEVKDGRAV LKAIPKV          237
//

If you have problems or comments...

PBIL Back to PBIL home page