(data stored in ACNUC7421 zone)

EMBL: CP000769.PE160

CP000769.PE160       Location/Qualifiers
FT   CDS             complement(189630..190280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3781 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N4"
FT                   /protein_id="ABS24380.1"
FT                   /translation="MDRQRVAVVVALALAGLAAPVTASAGFVVGARVGWAFPFGELRNG
FT                   VDLDSAVRGQIPLQVDLGWRFADRLMLGGYARLSPGVVGDNVEDACDASSLDCDGPFGW
FT                   AVGGQVDVRLAPGNAGPWIGAFGGFEALTYGDVSEAVDTDSLELSYEGWEVGAQGGIDF
FT                   AWGPIVIGPWASVSWGRFTEISAEIGGRDTDIPEWDEATHTWVQVGLRGALDF"
     MDRQRVAVVV ALALAGLAAP VTASAGFVVG ARVGWAFPFG ELRNGVDLDS AVRGQIPLQV        60
     DLGWRFADRL MLGGYARLSP GVVGDNVEDA CDASSLDCDG PFGWAVGGQV DVRLAPGNAG       120
     PWIGAFGGFE ALTYGDVSEA VDTDSLELSY EGWEVGAQGG IDFAWGPIVI GPWASVSWGR       180
     FTEISAEIGG RDTDIPEWDE ATHTWVQVGL RGALDF                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page