(data stored in ACNUC7421 zone)

EMBL: CP000769.PE167

CP000769.PE167       Location/Qualifiers
FT   CDS             complement(196202..196615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0169"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mxa:MXAN_6484 transport energizing protein, ExbD/TolR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24387"
FT                   /db_xref="GOA:A7H6P1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P1"
FT                   /protein_id="ABS24387.1"
FT                   /translation="MAGLSGGENDDDLISGINVTPLVDVVLVLLIIFMVTATYIVRAAI
FT                   EVELPRAAHGGETTGTVLTVVLTRDGKVYLDGVERTEQELVARTREAVRKDAGTRAVIS
FT                   ADKGALHGAVVRAIDLVRDGGVTRFAIHVERER"
     MAGLSGGEND DDLISGINVT PLVDVVLVLL IIFMVTATYI VRAAIEVELP RAAHGGETTG        60
     TVLTVVLTRD GKVYLDGVER TEQELVARTR EAVRKDAGTR AVISADKGAL HGAVVRAIDL       120
     VRDGGVTRFA IHVERER                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page