(data stored in ACNUC7421 zone)

EMBL: CP000769.PE168

CP000769.PE168       Location/Qualifiers
FT   CDS             complement(196619..197248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0170"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mxa:MXAN_0818 MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24388"
FT                   /db_xref="GOA:A7H6P2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P2"
FT                   /protein_id="ABS24388.1"
FT                   /translation="MLQKQLLGFTNLGAEWVLWLLIALSVASIGVMIERVAFFLSRRAG
FT                   DVDALRRQLLAGDLAGASAAVEGRRGMEAEVVRAAVAHAAMGPDAVREVVSGTIERSRI
FT                   DYEQRLAFLGTLGNNAPFIGLFGTVLGIVRAFFELSRNPGAAGAGTVMAGISEALVATA
FT                   VGLFVALPAVVAYNLFQRGLRRTAQRATALGHAAIAHLEARPGREA"
     MLQKQLLGFT NLGAEWVLWL LIALSVASIG VMIERVAFFL SRRAGDVDAL RRQLLAGDLA        60
     GASAAVEGRR GMEAEVVRAA VAHAAMGPDA VREVVSGTIE RSRIDYEQRL AFLGTLGNNA       120
     PFIGLFGTVL GIVRAFFELS RNPGAAGAGT VMAGISEALV ATAVGLFVAL PAVVAYNLFQ       180
     RGLRRTAQRA TALGHAAIAH LEARPGREA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page