(data stored in ACNUC7421 zone)

EMBL: CP000769.PE169

CP000769.PE169       Location/Qualifiers
FT   CDS             197724..199214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0171"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814; KEGG:
FT                   ade:Adeh_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24389"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P3"
FT                   /protein_id="ABS24389.1"
FT                   /translation="MSLGAGEIEAVVRELAPLVGSRVDAVRVHAERALTLELFGRAGPV
FT                   LLLLSAEPDVTRLHVTRARPPQPATPFPFQVLLRREIEGARLAAIETLPGDRVVALALE
FT                   TPRGRLRLVGELTGRHGNLFLLGDDGIIRASAGRNLSQRRKLVAGEPYVAPAPPPSPRV
FT                   ERPRFTAEPSGPFPLSAAVEARYAALVQERLVAEGRRRLREPVRAGVARASRALEKLAD
FT                   EAARVPVAEADRRAADLLKANLRAVKRGEREVTLTEWTEEGPREVRVALDPALAPQANM
FT                   ERLYRRYRRIVESAERVAARTAGVRGREAALRSLLGEIDSAPLEELPRLEREARRLGAG
FT                   PRPQPQPQPRPAGPGGRARARPEPLPYRVFRSAAGAAILVGRGAAENDRLTLRVARGND
FT                   LWLHARGVPGAHVVVRLEKGRGPDQGTLLDAAHLALHFSDARGAPQADVAYTRAKYVRK
FT                   PKGAGPGAVTYSQEKVLLLRTEPQRIARLLAEEEGGQE"
     MSLGAGEIEA VVRELAPLVG SRVDAVRVHA ERALTLELFG RAGPVLLLLS AEPDVTRLHV        60
     TRARPPQPAT PFPFQVLLRR EIEGARLAAI ETLPGDRVVA LALETPRGRL RLVGELTGRH       120
     GNLFLLGDDG IIRASAGRNL SQRRKLVAGE PYVAPAPPPS PRVERPRFTA EPSGPFPLSA       180
     AVEARYAALV QERLVAEGRR RLREPVRAGV ARASRALEKL ADEAARVPVA EADRRAADLL       240
     KANLRAVKRG EREVTLTEWT EEGPREVRVA LDPALAPQAN MERLYRRYRR IVESAERVAA       300
     RTAGVRGREA ALRSLLGEID SAPLEELPRL EREARRLGAG PRPQPQPQPR PAGPGGRARA       360
     RPEPLPYRVF RSAAGAAILV GRGAAENDRL TLRVARGNDL WLHARGVPGA HVVVRLEKGR       420
     GPDQGTLLDA AHLALHFSDA RGAPQADVAY TRAKYVRKPK GAGPGAVTYS QEKVLLLRTE       480
     PQRIARLLAE EEGGQE                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page