(data stored in ACNUC7421 zone)

EMBL: CP000769.PE17

CP000769.PE17        Location/Qualifiers
FT   CDS             21289..21699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24237"
FT                   /db_xref="UniProtKB/TrEMBL:A7H691"
FT                   /protein_id="ABS24237.1"
FT                   /translation="MPRGPWEEVRLRTLALAAAVSLLAACGASKELEVQRARLHAERRA
FT                   LEATFDHLEDRLLVNQARVRFWQEMRERHEGVTAVACTSLEQHAEEIARRMAPPPARQA
FT                   SAVRTSLHESRVAARAVPRAEPSPAARAARSE"
     MPRGPWEEVR LRTLALAAAV SLLAACGASK ELEVQRARLH AERRALEATF DHLEDRLLVN        60
     QARVRFWQEM RERHEGVTAV ACTSLEQHAE EIARRMAPPP ARQASAVRTS LHESRVAARA       120
     VPRAEPSPAA RAARSE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page