(data stored in ACNUC7421 zone)

EMBL: CP000769.PE170

CP000769.PE170       Location/Qualifiers
FT   CDS             199319..200107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P4"
FT                   /protein_id="ABS24390.1"
FT                   /translation="MPPSVGSRPPVPRPPQANRQLELFDARRASREARLSAASRLADSL
FT                   SGILSERVRLTVHDNRSTMVSFRRGSGGIHYRLHHMFLGAPGEVVRALAAFAGPTRGAS
FT                   ARRREAGSRIDAFVRHNRARIAVPRADRLQPRGRAHDLQQIFDRLNAAHFGDAIQAHIG
FT                   WGAVRGGARRRTVKTGVYVQDARIIRIHPTLDRPEVPEFYVALVVFHEMLHQAVPAREV
FT                   NGRRVVHGAEFRRRERAYPDYARAKAWEEGNLGLLLSSPT"
     MPPSVGSRPP VPRPPQANRQ LELFDARRAS REARLSAASR LADSLSGILS ERVRLTVHDN        60
     RSTMVSFRRG SGGIHYRLHH MFLGAPGEVV RALAAFAGPT RGASARRREA GSRIDAFVRH       120
     NRARIAVPRA DRLQPRGRAH DLQQIFDRLN AAHFGDAIQA HIGWGAVRGG ARRRTVKTGV       180
     YVQDARIIRI HPTLDRPEVP EFYVALVVFH EMLHQAVPAR EVNGRRVVHG AEFRRRERAY       240
     PDYARAKAWE EGNLGLLLSS PT                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page