(data stored in ACNUC7421 zone)

EMBL: CP000769.PE173

CP000769.PE173       Location/Qualifiers
FT   CDS             complement(206764..207969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0175"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: ade:Adeh_0166 integral membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24393"
FT                   /db_xref="GOA:A7H6P7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P7"
FT                   /protein_id="ABS24393.1"
FT                   /translation="MDRRRSLVVTAALAGLWLAVGYVNVARGAAHAGPGYRFWSFQHHC
FT                   YSDVIALHGDRYLGGSHPLPYLEDRIEYPVLLGIALWLPSYAPGGALGHFTATYLVLAA
FT                   CLAAALLALARLPGALPWWLGATPALVYYAGLNWDVLPIALLSGALLAQERGRAGAGAA
FT                   AAALGVSAKLFPATLVPAALAALAATRPRALLRYAVVFAGVVLAVNLPFALAAPERWSW
FT                   FFRFNAGRGAENSVWQALAVPRGPLLEALSAGPLAAAAIAGAVATACAARRGGDAARAA
FT                   RLATALALVVWIATNKVWSPQYALYGFLAGALAAGPAALFAALTAVSIWDFHVAFEVRA
FT                   RRWEPWFRDHLFHPTAVVRTLLWLALAALIARALWREARGPADAATGGRAGPGGATLGA
FT                   RQ"
     MDRRRSLVVT AALAGLWLAV GYVNVARGAA HAGPGYRFWS FQHHCYSDVI ALHGDRYLGG        60
     SHPLPYLEDR IEYPVLLGIA LWLPSYAPGG ALGHFTATYL VLAACLAAAL LALARLPGAL       120
     PWWLGATPAL VYYAGLNWDV LPIALLSGAL LAQERGRAGA GAAAAALGVS AKLFPATLVP       180
     AALAALAATR PRALLRYAVV FAGVVLAVNL PFALAAPERW SWFFRFNAGR GAENSVWQAL       240
     AVPRGPLLEA LSAGPLAAAA IAGAVATACA ARRGGDAARA ARLATALALV VWIATNKVWS       300
     PQYALYGFLA GALAAGPAAL FAALTAVSIW DFHVAFEVRA RRWEPWFRDH LFHPTAVVRT       360
     LLWLALAALI ARALWREARG PADAATGGRA GPGGATLGAR Q                           401
//

If you have problems or comments...

PBIL Back to PBIL home page