(data stored in ACNUC7421 zone)

EMBL: CP000769.PE175

CP000769.PE175       Location/Qualifiers
FT   CDS             208729..209703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0177"
FT                   /product="transglutaminase-like protein"
FT                   /note="KEGG: ade:Adeh_0168 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24395"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P9"
FT                   /protein_id="ABS24395.1"
FT                   /translation="MSAAAALAALLALGLPEGAARYRVELGGVTVGLAELELRCGRERC
FT                   RARWETRLRLPEEAGGAVTTRRFETELDRAGRAVGRMRRTRDAEIARLEVPSGRVPAGL
FT                   AEALLATAAGRGEAACVEVFEEETLATGRACGAWEGDTLHATVLGVEERVTFAADGLPE
FT                   TVALASDGARFLRDRRAAVPSRPPRLTARVAGPGDPARAESFCGVPVDPPPPRAPPGLP
FT                   APRAAGESCREKTAAYLATAAAAGHEGRTAIGVAWDGDGFVWHAWAELLADGSWVPVDP
FT                   SFGELPARGPRFTVARHGAGRAAALAAGRRVLACWGRAGVLAR"
     MSAAAALAAL LALGLPEGAA RYRVELGGVT VGLAELELRC GRERCRARWE TRLRLPEEAG        60
     GAVTTRRFET ELDRAGRAVG RMRRTRDAEI ARLEVPSGRV PAGLAEALLA TAAGRGEAAC       120
     VEVFEEETLA TGRACGAWEG DTLHATVLGV EERVTFAADG LPETVALASD GARFLRDRRA       180
     AVPSRPPRLT ARVAGPGDPA RAESFCGVPV DPPPPRAPPG LPAPRAAGES CREKTAAYLA       240
     TAAAAGHEGR TAIGVAWDGD GFVWHAWAEL LADGSWVPVD PSFGELPARG PRFTVARHGA       300
     GRAAALAAGR RVLACWGRAG VLAR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page