(data stored in ACNUC7421 zone)

EMBL: CP000769.PE177

CP000769.PE177       Location/Qualifiers
FT   CDS             complement(210286..211434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0179"
FT                   /product="Glutamate carboxypeptidase"
FT                   /EC_number="3.4.17.11"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: ade:Adeh_0170 glutamate carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24397"
FT                   /db_xref="GOA:A7H6Q1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q1"
FT                   /protein_id="ABS24397.1"
FT                   /translation="MAARLDDALTWLAGQRGAMESLLERLVTVNSFTGNKAGVQSVANL
FT                   VAGQLRTLGLSVELRPSARFGPHLLFSGAADGAPVFLLGHTDTVFPPGTFEGFRRDGAR
FT                   AVGPGVFDMKGGIVVMLFGLVAAKRAGLLERVAVRGILVADEEVGSPESQPLTRTHAQG
FT                   AACALGFESGRPGDLLVTRRKGVGSLHAEARGVASHAGNEHDKGRNAIWSIARFVDRVQ
FT                   GLTDYERGVTVSVGLVSGGTTKNTVPAEARCDVDLRFETAADGLALAEAAEAIAAEAAV
FT                   PGTTLALSRGGWRDPLERTQASSALAKEYGDCQRESGLGLGEAPLVGGGSDACTTGAAG
FT                   IPSIDGLGPRGRGFHTAGEEVDLSTLVPKASAFLRFLARRGA"
     MAARLDDALT WLAGQRGAME SLLERLVTVN SFTGNKAGVQ SVANLVAGQL RTLGLSVELR        60
     PSARFGPHLL FSGAADGAPV FLLGHTDTVF PPGTFEGFRR DGARAVGPGV FDMKGGIVVM       120
     LFGLVAAKRA GLLERVAVRG ILVADEEVGS PESQPLTRTH AQGAACALGF ESGRPGDLLV       180
     TRRKGVGSLH AEARGVASHA GNEHDKGRNA IWSIARFVDR VQGLTDYERG VTVSVGLVSG       240
     GTTKNTVPAE ARCDVDLRFE TAADGLALAE AAEAIAAEAA VPGTTLALSR GGWRDPLERT       300
     QASSALAKEY GDCQRESGLG LGEAPLVGGG SDACTTGAAG IPSIDGLGPR GRGFHTAGEE       360
     VDLSTLVPKA SAFLRFLARR GA                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page