(data stored in ACNUC7421 zone)

EMBL: CP000769.PE180

CP000769.PE180       Location/Qualifiers
FT   CDS             complement(213450..214454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0182"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sus:Acid_4473 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24400"
FT                   /db_xref="GOA:A7H6Q4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q4"
FT                   /protein_id="ABS24400.1"
FT                   /translation="MDQLGVATVLRLFLRGSRNYLADRPLVVSFELTGSCNARCKHCDK
FT                   GGILRDETPLSPQRIGEIYRELRPVAVQLSGGEPLLRRDVVEVARAIKERRGAPYLIVV
FT                   SNGTLLSAPKYEALRAAGVNQFSISLDFPDERHDDFRSVPGLFRRLERLVPELTSRGHG
FT                   DVVLNCAVSRLNAGDLTRLCETARRWGSSISFSAYSALRTGNTDYLVSSPEDLRGLRAQ
FT                   LDAVLDLKRRGGPVRNPAPDLDGLYRFFADGGIPGCRAGYRFLLVTPEGFFRPCAHKPV
FT                   KARSQRELIQRFARTNDCRGCYVAIRSYCDKSYLPLLREQVLTRLGLSAAAPR"
     MDQLGVATVL RLFLRGSRNY LADRPLVVSF ELTGSCNARC KHCDKGGILR DETPLSPQRI        60
     GEIYRELRPV AVQLSGGEPL LRRDVVEVAR AIKERRGAPY LIVVSNGTLL SAPKYEALRA       120
     AGVNQFSISL DFPDERHDDF RSVPGLFRRL ERLVPELTSR GHGDVVLNCA VSRLNAGDLT       180
     RLCETARRWG SSISFSAYSA LRTGNTDYLV SSPEDLRGLR AQLDAVLDLK RRGGPVRNPA       240
     PDLDGLYRFF ADGGIPGCRA GYRFLLVTPE GFFRPCAHKP VKARSQRELI QRFARTNDCR       300
     GCYVAIRSYC DKSYLPLLRE QVLTRLGLSA AAPR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page