(data stored in ACNUC7421 zone)

EMBL: CP000769.PE185

CP000769.PE185       Location/Qualifiers
FT   CDS             complement(218428..219522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0187"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   aba:Acid345_0559 ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24405"
FT                   /db_xref="GOA:A7H6Q9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q9"
FT                   /protein_id="ABS24405.1"
FT                   /translation="MTLALANVLQKKVRSAICVLAIGIGVALLLVVVGLTRGSIQEVAQ
FT                   RIQNVGGDLIVQPAGATQFLALKSGVLPERYAERLRALPGVAAVSPVVAWTTTFRNAFY
FT                   VVYGIDPEQFSSIGGGLRIVEGRPLRGRGEVVVDSRLAAAARLAVGDRVEILGARFEIV
FT                   GVSKEGVGARIFLPMAELQAMLHQERRVSLFFVRCTSPGAVKSTAAAIEAAIEGVRCQI
FT                   LEGLADEMARSMTGLREFIGAITGTTLVVSLLVVSLAMYMTILGKTREIGILRSLGASR
FT                   RRIMGTVVLESLLLTGCGVLAGYALTLASVAALRSWYPLLTVEVTRFWILVGGGVGIAS
FT                   GLLGALYPAWFAARQDPVQALSYE"
     MTLALANVLQ KKVRSAICVL AIGIGVALLL VVVGLTRGSI QEVAQRIQNV GGDLIVQPAG        60
     ATQFLALKSG VLPERYAERL RALPGVAAVS PVVAWTTTFR NAFYVVYGID PEQFSSIGGG       120
     LRIVEGRPLR GRGEVVVDSR LAAAARLAVG DRVEILGARF EIVGVSKEGV GARIFLPMAE       180
     LQAMLHQERR VSLFFVRCTS PGAVKSTAAA IEAAIEGVRC QILEGLADEM ARSMTGLREF       240
     IGAITGTTLV VSLLVVSLAM YMTILGKTRE IGILRSLGAS RRRIMGTVVL ESLLLTGCGV       300
     LAGYALTLAS VAALRSWYPL LTVEVTRFWI LVGGGVGIAS GLLGALYPAW FAARQDPVQA       360
     LSYE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page