(data stored in ACNUC7421 zone)

EMBL: CP000769.PE189

CP000769.PE189       Location/Qualifiers
FT   CDS             225766..226755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0191"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; TGS domain
FT                   protein; KEGG: ade:Adeh_2114 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24409"
FT                   /db_xref="GOA:A7H6R3"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R3"
FT                   /protein_id="ABS24409.1"
FT                   /translation="MPANLTTQYKDAELRFRQATDHDAKREALREMLALLPKHKGTEKL
FT                   HADLKKRLAKLEEEAGHAARGGHRADPGHVRREGAGQWILVGPPNAGKSSLLAALTHAH
FT                   PEIGEYPFTTRAPLPGMAAVEDVQVQLVDTPPVAAGHTEPYLPNLVQGADGVIVVLDPT
FT                   ADDVAQAFAAVLEVLSRGHVWPRGRAPPQGASPLLVARPVLVVATRRDLDDGGTFAALA
FT                   RDAAGAELPFFAVSATRGDGLDALRPELFRALGRIRVYTKEPGKKPDLGKPFVLPAGAT
FT                   VHDLAALVHHDVAAHLKFARIWGHARFEGQQVDRHHVLADRDVVELHA"
     MPANLTTQYK DAELRFRQAT DHDAKREALR EMLALLPKHK GTEKLHADLK KRLAKLEEEA        60
     GHAARGGHRA DPGHVRREGA GQWILVGPPN AGKSSLLAAL THAHPEIGEY PFTTRAPLPG       120
     MAAVEDVQVQ LVDTPPVAAG HTEPYLPNLV QGADGVIVVL DPTADDVAQA FAAVLEVLSR       180
     GHVWPRGRAP PQGASPLLVA RPVLVVATRR DLDDGGTFAA LARDAAGAEL PFFAVSATRG       240
     DGLDALRPEL FRALGRIRVY TKEPGKKPDL GKPFVLPAGA TVHDLAALVH HDVAAHLKFA       300
     RIWGHARFEG QQVDRHHVLA DRDVVELHA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page