(data stored in ACNUC7421 zone)

EMBL: CP000769.PE2

CP000769.PE2         Location/Qualifiers
FT   CDS             1847..2977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: ade:Adeh_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24222"
FT                   /db_xref="GOA:A7H676"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A7H676"
FT                   /protein_id="ABS24222.1"
FT                   /translation="MELKIGVAELAKALGRSQGIVEKKSTMPILSHVLLEAKGGHLVVS
FT                   ATDLDLAVSSEHGEHCEVLKEGALAVSARHLYEIVRALPEQQVTLKRAHNNYLEVRSGP
FT                   SEFRIVGLPAEDFPALPRFEKVTFSDVKPEDLLDMIERTFFAVSNDETRYNLNGVYFEP
FT                   GPEVLRLVATDGHRLSLSERSIGGTFGLKRGVILPKKGLHELRKLLGEAVEAGADAGET
FT                   KLGFVENSAIFRRPGVILSMRLIEGLFPDYRQVIPKQGEKVLRLGRDRFLETLRRVSLL
FT                   SSDKAHAVKLELGQGTLKVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYLMDVLGVVK
FT                   SAEVQLELADDLSPGVMRGGDEKDAGFTAVVMPMRI"
     MELKIGVAEL AKALGRSQGI VEKKSTMPIL SHVLLEAKGG HLVVSATDLD LAVSSEHGEH        60
     CEVLKEGALA VSARHLYEIV RALPEQQVTL KRAHNNYLEV RSGPSEFRIV GLPAEDFPAL       120
     PRFEKVTFSD VKPEDLLDMI ERTFFAVSND ETRYNLNGVY FEPGPEVLRL VATDGHRLSL       180
     SERSIGGTFG LKRGVILPKK GLHELRKLLG EAVEAGADAG ETKLGFVENS AIFRRPGVIL       240
     SMRLIEGLFP DYRQVIPKQG EKVLRLGRDR FLETLRRVSL LSSDKAHAVK LELGQGTLKV       300
     LSQNPDLGEA KEEVPVEYAG EPLKIGFNAR YLMDVLGVVK SAEVQLELAD DLSPGVMRGG       360
     DEKDAGFTAV VMPMRI                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page