(data stored in ACNUC7421 zone)

EMBL: CP000769.PE203

CP000769.PE203       Location/Qualifiers
FT   CDS             238284..239123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0205"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: ade:Adeh_0185
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24423"
FT                   /db_xref="GOA:A7H6S7"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6S7"
FT                   /protein_id="ABS24423.1"
FT                   /translation="MITGRTALYGVLGNPVRHSRSPQMQAAAFEHLGLDATYVALPVEP
FT                   ERLPAAVAGAHALGFQGLNVTVPHKRAVVALCEAVDPVAREVGAVNTLRRTERGWEGFN
FT                   TDAAACLMLLREEGLRPGAPALLAGAGGAARAAAWALVRAGAVLRIAARRQDAAERLAA
FT                   ELGPLAGPGTPAPVAVPWGALEAEADAAEAVVNGTTVGLHPEDAPLPLRVRAGQLVADF
FT                   VYGDTPLARAARDAGARLVSGERILVRQGALSFALWTGRAAPEALMAAAIAAPGRAT"
     MITGRTALYG VLGNPVRHSR SPQMQAAAFE HLGLDATYVA LPVEPERLPA AVAGAHALGF        60
     QGLNVTVPHK RAVVALCEAV DPVAREVGAV NTLRRTERGW EGFNTDAAAC LMLLREEGLR       120
     PGAPALLAGA GGAARAAAWA LVRAGAVLRI AARRQDAAER LAAELGPLAG PGTPAPVAVP       180
     WGALEAEADA AEAVVNGTTV GLHPEDAPLP LRVRAGQLVA DFVYGDTPLA RAARDAGARL       240
     VSGERILVRQ GALSFALWTG RAAPEALMAA AIAAPGRAT                              279
//

If you have problems or comments...

PBIL Back to PBIL home page