(data stored in ACNUC7421 zone)

EMBL: CP000769.PE209

CP000769.PE209       Location/Qualifiers
FT   CDS             243522..244613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24429"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T3"
FT                   /protein_id="ABS24429.1"
FT                   /translation="MVLMRSPSSVGSGPAPSFDLAAFRRALTDRTAAAVKALRAQIGSE
FT                   TLYAFALYTSAESGYAWVEASANTEEGLARAATSRAADDPRFRGEAGRRLLRWSVEDWA
FT                   HHDFDAAVRAVPLPDPLERRESLDRALLTAMVGALRTLDRAGLFGRGADRAFLTVNVLC
FT                   PHPSRAFFVRNLRALNPVPTVERHLRETDPAPFVRAVNRAPRRERMRIWLALYEDLYME
FT                   WKTPIAEEARARGMSPWEVEVELARFGPKVVPKLVDLLAHYGFAPPFDSARELETREVW
FT                   LAGSALFLVRRIGLVPESQIRRLQALVGAFEERDRRLKIASTLAENTARVLHELRPRKF
FT                   PESVMDPQTYKLLNPEPFLPRRP"
     MVLMRSPSSV GSGPAPSFDL AAFRRALTDR TAAAVKALRA QIGSETLYAF ALYTSAESGY        60
     AWVEASANTE EGLARAATSR AADDPRFRGE AGRRLLRWSV EDWAHHDFDA AVRAVPLPDP       120
     LERRESLDRA LLTAMVGALR TLDRAGLFGR GADRAFLTVN VLCPHPSRAF FVRNLRALNP       180
     VPTVERHLRE TDPAPFVRAV NRAPRRERMR IWLALYEDLY MEWKTPIAEE ARARGMSPWE       240
     VEVELARFGP KVVPKLVDLL AHYGFAPPFD SARELETREV WLAGSALFLV RRIGLVPESQ       300
     IRRLQALVGA FEERDRRLKI ASTLAENTAR VLHELRPRKF PESVMDPQTY KLLNPEPFLP       360
     RRP                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page