(data stored in ACNUC7421 zone)

EMBL: CP000769.PE211

CP000769.PE211       Location/Qualifiers
FT   CDS             complement(245543..245839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0213"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: ade:Adeh_0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24431"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T5"
FT                   /protein_id="ABS24431.1"
FT                   /translation="MPIYEYECPKCGRFDHLQKMSSPALEVHDVCGSKVTKLMSASAFA
FT                   FKGSGFYITDYNGRNSAAITGKGDKAESKPEPKVESKPDACATCPAKQGAGAC"
     MPIYEYECPK CGRFDHLQKM SSPALEVHDV CGSKVTKLMS ASAFAFKGSG FYITDYNGRN        60
     SAAITGKGDK AESKPEPKVE SKPDACATCP AKQGAGAC                                98
//

If you have problems or comments...

PBIL Back to PBIL home page