(data stored in ACNUC7421 zone)

EMBL: CP000769.PE214

CP000769.PE214       Location/Qualifiers
FT   CDS             247919..248365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0216"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   ade:Adeh_0199 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24434"
FT                   /db_xref="GOA:A7H6T8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T8"
FT                   /protein_id="ABS24434.1"
FT                   /translation="MADWRANILDDDAALRPLLRSTRRVAVLGMKTEAQASQAAFYVPQ
FT                   YLAGQGVEVVPVPVYYPEVQEILGRRVYRSLAAVPGDIDLVDVFRRPRDVPGHLDDLLA
FT                   KRPRAVWLQLGIRHDAVAEQLARAGIQVVQDRCLMVDWRRLVSG"
     MADWRANILD DDAALRPLLR STRRVAVLGM KTEAQASQAA FYVPQYLAGQ GVEVVPVPVY        60
     YPEVQEILGR RVYRSLAAVP GDIDLVDVFR RPRDVPGHLD DLLAKRPRAV WLQLGIRHDA       120
     VAEQLARAGI QVVQDRCLMV DWRRLVSG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page