(data stored in ACNUC7421 zone)

EMBL: CP000769.PE216

CP000769.PE216       Location/Qualifiers
FT   CDS             complement(249473..251272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0218"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ade:Adeh_0203 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24436"
FT                   /db_xref="GOA:A7H6U0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U0"
FT                   /protein_id="ABS24436.1"
FT                   /translation="MQDVLGNTLGLKPSQLHALRRTYRRRVDAASIVSPELARHLSEVS
FT                   RETNRQIGVLLDRKGDVHSVIVGDARKLELPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGKVHFAHLVPENAQGAMWKDEAAASVHDLAYDA
FT                   LSGALALEEEFARARAVRRTGGRERAILVGFGGKGRSRADAESSLEELKELARTAGVEV
FT                   IDATVQLRRDPDPRYLIGKGKLEDVVLRSMQLMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEALGSSRQLRRKQRNGRGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELSDA
FT                   DLLLHVVDASDPRHPEQIEAVETILASLGLEQKQRLLVFNKADRLPPGEGAALAHRAEG
FT                   IAVSALSRDGLAELLHLCDRLLWEDRRVAFADVAASAPPPPATPEPGEEGAARAAATDR
FT                   AAPEPTPPSPAARLLPSRIARVS"
     MQDVLGNTLG LKPSQLHALR RTYRRRVDAA SIVSPELARH LSEVSRETNR QIGVLLDRKG        60
     DVHSVIVGDA RKLELPDVGR GRAGESRLRG LRLVHTHLNG EPLTRDDHTD LALLRLDLVA       120
     AIEVREDGLP GKVHFAHLVP ENAQGAMWKD EAAASVHDLA YDALSGALAL EEEFARARAV       180
     RRTGGRERAI LVGFGGKGRS RADAESSLEE LKELARTAGV EVIDATVQLR RDPDPRYLIG       240
     KGKLEDVVLR SMQLMATVIV FDAELSPSQA RHIAEATSLK ILDRTQLILD IFAQRAQSAD       300
     GKLQVELAQL KYLYPRLVGR DDSLSRLAGG IGGRGPGETK LEIDRRRVRD RITALERRIE       360
     ALGSSRQLRR KQRNGRGLPV LSIVGYTNAG KSTLLNALTD SAVLAEDKLF ATLDPTSRRL       420
     RFPRDREVII TDTVGFIRDL PPDLVNAFRA TLEELSDADL LLHVVDASDP RHPEQIEAVE       480
     TILASLGLEQ KQRLLVFNKA DRLPPGEGAA LAHRAEGIAV SALSRDGLAE LLHLCDRLLW       540
     EDRRVAFADV AASAPPPPAT PEPGEEGAAR AAATDRAAPE PTPPSPAARL LPSRIARVS        599
//

If you have problems or comments...

PBIL Back to PBIL home page