(data stored in ACNUC7421 zone)

EMBL: CP000769.PE218

CP000769.PE218       Location/Qualifiers
FT   CDS             251903..252619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: nha:Nham_3915 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24438"
FT                   /db_xref="GOA:A7H6U2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U2"
FT                   /protein_id="ABS24438.1"
FT                   /translation="MQRVPHGRAAPTLQDMARPEAVLLDVDGTMVDSVDLHARAWQEAL
FT                   RRFGRDVPLPEVRRQIGKGGDQLVPVFLPPEQLAREGEALERFRAELWRREYMAQVRPF
FT                   PGARALLRRAREAGLRVALASSGSEEEVAHNRRLLDVDALLEGSTTSDDAARSKPHPDI
FT                   FEAALARVRAPPERAIAVGDSPWDALAAGRAGVRTVGLLSGGFEERELREAGCVAIYAG
FT                   PADLLARFDESPLARG"
     MQRVPHGRAA PTLQDMARPE AVLLDVDGTM VDSVDLHARA WQEALRRFGR DVPLPEVRRQ        60
     IGKGGDQLVP VFLPPEQLAR EGEALERFRA ELWRREYMAQ VRPFPGARAL LRRAREAGLR       120
     VALASSGSEE EVAHNRRLLD VDALLEGSTT SDDAARSKPH PDIFEAALAR VRAPPERAIA       180
     VGDSPWDALA AGRAGVRTVG LLSGGFEERE LREAGCVAIY AGPADLLARF DESPLARG         238
//

If you have problems or comments...

PBIL Back to PBIL home page