(data stored in ACNUC7421 zone)

EMBL: CP000769.PE219

CP000769.PE219       Location/Qualifiers
FT   CDS             252794..254053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_0206 major
FT                   facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24439"
FT                   /db_xref="GOA:A7H6U3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U3"
FT                   /protein_id="ABS24439.1"
FT                   /translation="MATLVSPEAGAPAGARSVLNAAVIVAALGYFVDIYDLILVSIVRK
FT                   PSLTALGVAPELLLTEGFSILNWQMIGMLLGGIVFGVVGDKLGRLQILFGSITLYSLAT
FT                   LANGFVTDLSTYKVLRFVAGLGLAGELGAGVTLVSEILPARLRGYGTMIVASVGVSGAV
FT                   AGNLVAKWLDWRWAYFVGGGLGLVLLVLRIKVHESGMFRKVARQAGISRGDFFSLFTDR
FT                   ERFTRYLASILIAVPIWFANAILVLGAPEFAQALGVTGPVSAGDAVMFFYGGLVVGDVA
FT                   SGSLSQLLRSRRRVVLLFLSLLAAAIAAYFLAGRGASPGLFLALCGLLGVTSGYWAIFV
FT                   TIAAEQFGTNIRATVATTVPNFVRGLVVVVTSTFVWLRPQVGLVGGALAVGAIWFALAL
FT                   GSALRLRETFGIDLDYVERD"
     MATLVSPEAG APAGARSVLN AAVIVAALGY FVDIYDLILV SIVRKPSLTA LGVAPELLLT        60
     EGFSILNWQM IGMLLGGIVF GVVGDKLGRL QILFGSITLY SLATLANGFV TDLSTYKVLR       120
     FVAGLGLAGE LGAGVTLVSE ILPARLRGYG TMIVASVGVS GAVAGNLVAK WLDWRWAYFV       180
     GGGLGLVLLV LRIKVHESGM FRKVARQAGI SRGDFFSLFT DRERFTRYLA SILIAVPIWF       240
     ANAILVLGAP EFAQALGVTG PVSAGDAVMF FYGGLVVGDV ASGSLSQLLR SRRRVVLLFL       300
     SLLAAAIAAY FLAGRGASPG LFLALCGLLG VTSGYWAIFV TIAAEQFGTN IRATVATTVP       360
     NFVRGLVVVV TSTFVWLRPQ VGLVGGALAV GAIWFALALG SALRLRETFG IDLDYVERD        419
//

If you have problems or comments...

PBIL Back to PBIL home page