(data stored in ACNUC7421 zone)

EMBL: CP000769.PE220

CP000769.PE220       Location/Qualifiers
FT   CDS             254063..254581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24440"
FT                   /db_xref="GOA:A7H6U4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U4"
FT                   /protein_id="ABS24440.1"
FT                   /translation="MSLYVVDVEADGPIPGKYSMVSLGAVLVEPGLGRTFYGRTRPIAD
FT                   AFLPDALAVSATTREEHLRFDEPGEVMAAFERWIQETTRGKPVFFSDNLAFDWQFVNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDAYAQWKHLRKTGHDHHPVNDAKGNAEALLAMI
FT                   DMGLKLTAR"
     MSLYVVDVEA DGPIPGKYSM VSLGAVLVEP GLGRTFYGRT RPIADAFLPD ALAVSATTRE        60
     EHLRFDEPGE VMAAFERWIQ ETTRGKPVFF SDNLAFDWQF VNWYFHTYLG RNPFGWSGRR       120
     IGDLYCGMVK DAYAQWKHLR KTGHDHHPVN DAKGNAEALL AMIDMGLKLT AR               172
//

If you have problems or comments...

PBIL Back to PBIL home page