(data stored in ACNUC7421 zone)

EMBL: CP000769.PE222

CP000769.PE222       Location/Qualifiers
FT   CDS             255348..255965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0224"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ade:Adeh_0208 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24442"
FT                   /db_xref="GOA:A7H6U6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U6"
FT                   /protein_id="ABS24442.1"
FT                   /translation="MISPAALTLFLTGATLGLSAAAQPGPYQAYLLAQSLRNGAARTLP
FT                   VALVPFVSDPAVIAVVLVVLAQVPAGFLRVLQIVGGAVVLWLAVATLRAARAGGPVEGR
FT                   APPRGFVRAAVVNLTNPNAWMFWSLVGGPVLAEAWRDAPVRALAFLAGFYLFLTGGNFA
FT                   LVGLASAASRLGPRFTRALGLVSGAALLAFGAWQIGRGLAGA"
     MISPAALTLF LTGATLGLSA AAQPGPYQAY LLAQSLRNGA ARTLPVALVP FVSDPAVIAV        60
     VLVVLAQVPA GFLRVLQIVG GAVVLWLAVA TLRAARAGGP VEGRAPPRGF VRAAVVNLTN       120
     PNAWMFWSLV GGPVLAEAWR DAPVRALAFL AGFYLFLTGG NFALVGLASA ASRLGPRFTR       180
     ALGLVSGAAL LAFGAWQIGR GLAGA                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page