(data stored in ACNUC7421 zone)

EMBL: CP000769.PE226

CP000769.PE226       Location/Qualifiers
FT   CDS             259027..259602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0228"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ade:Adeh_0213 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24446"
FT                   /db_xref="GOA:A7H6V0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V0"
FT                   /protein_id="ABS24446.1"
FT                   /translation="MAIKKKATAKKTAKKTKPLKKTARSRQAPARGGKELARRRGPAPV
FT                   SQALKRVPRAAKKPAASAGGPVSAAPAAAPQPDHARPTALAIAHAGLDKKAEEVTVLDV
FT                   RGLTSYADYFVVMTADSDRQASAIADHVEQTMKAQGVSKVGVEGYETGRWILVDYGDVV
FT                   AHVMNRESRGFYDLEGLWADAPRFAVEG"
     MAIKKKATAK KTAKKTKPLK KTARSRQAPA RGGKELARRR GPAPVSQALK RVPRAAKKPA        60
     ASAGGPVSAA PAAAPQPDHA RPTALAIAHA GLDKKAEEVT VLDVRGLTSY ADYFVVMTAD       120
     SDRQASAIAD HVEQTMKAQG VSKVGVEGYE TGRWILVDYG DVVAHVMNRE SRGFYDLEGL       180
     WADAPRFAVE G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page