(data stored in ACNUC7421 zone)

EMBL: CP000769.PE230

CP000769.PE230       Location/Qualifiers
FT   CDS             262950..264332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24450"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V4"
FT                   /protein_id="ABS24450.1"
FT                   /translation="MPLSVFVALALSAGAPSAPGACGCPDPETAPTGLLWRGAGPLPPG
FT                   ELARLAAPIVWFSRDEPLVVPGATPPPDPHPCDAEAPRDSPVVYWSLDRVQLRGTDQLA
FT                   RPVEEDARLMERAVSAVFRFFFYYREDVGVGHHPNDIELVDVTVNLVRESGCWEARVRS
FT                   VTGFAHGVDWYSNELAVQPDTRLPITILVEEGKHASCPDRNADGIYTPGYDVNRRINDA
FT                   WGVRDVIGSGFLLSSGYAASMTKPRTPIERVLPPEPGPPCATGRRSSVRDPDAALGRYV
FT                   LRPAREVPICLQAPEPRALEASMRRNHFGLDHEAPQRWFELGDALEQPINGTESLVPSI
FT                   ALRWDGGLGFAALFRGLDLRELYLVPRLSFVGVADALELLVTNSAARFASGYASAGVAR
FT                   EESEWRFVSEAGLKLRVTAKGWQRVLSLGYQFAGLRVGVRSSGFDPLEDLRFVAELGAG
FT                   VW"
     MPLSVFVALA LSAGAPSAPG ACGCPDPETA PTGLLWRGAG PLPPGELARL AAPIVWFSRD        60
     EPLVVPGATP PPDPHPCDAE APRDSPVVYW SLDRVQLRGT DQLARPVEED ARLMERAVSA       120
     VFRFFFYYRE DVGVGHHPND IELVDVTVNL VRESGCWEAR VRSVTGFAHG VDWYSNELAV       180
     QPDTRLPITI LVEEGKHASC PDRNADGIYT PGYDVNRRIN DAWGVRDVIG SGFLLSSGYA       240
     ASMTKPRTPI ERVLPPEPGP PCATGRRSSV RDPDAALGRY VLRPAREVPI CLQAPEPRAL       300
     EASMRRNHFG LDHEAPQRWF ELGDALEQPI NGTESLVPSI ALRWDGGLGF AALFRGLDLR       360
     ELYLVPRLSF VGVADALELL VTNSAARFAS GYASAGVARE ESEWRFVSEA GLKLRVTAKG       420
     WQRVLSLGYQ FAGLRVGVRS SGFDPLEDLR FVAELGAGVW                             460
//

If you have problems or comments...

PBIL Back to PBIL home page