(data stored in ACNUC7421 zone)

EMBL: CP000769.PE231

CP000769.PE231       Location/Qualifiers
FT   CDS             264326..264682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0233"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   cya:CYA_0899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24451"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V5"
FT                   /protein_id="ABS24451.1"
FT                   /translation="MVSPMSARDDRVRLKHMLDASRVVEAFAAGRTREDLDRDLQLTFA
FT                   LARAVEIVAEAAKDVSEERRMHHPGVPWRAIAATHHRLVHDPLALDLDRLWHIVSVDVP
FT                   VLIPHLRDALGETP"
     MVSPMSARDD RVRLKHMLDA SRVVEAFAAG RTREDLDRDL QLTFALARAV EIVAEAAKDV        60
     SEERRMHHPG VPWRAIAATH HRLVHDPLAL DLDRLWHIVS VDVPVLIPHL RDALGETP         118
//

If you have problems or comments...

PBIL Back to PBIL home page