(data stored in ACNUC7421 zone)

EMBL: CP000769.PE234

CP000769.PE234       Location/Qualifiers
FT   CDS             267079..270690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0236"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: ade:Adeh_0218 pyruvate-ferredoxin
FT                   (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24454"
FT                   /db_xref="GOA:A7H6V8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V8"
FT                   /protein_id="ABS24454.1"
FT                   /translation="MASRRMVTMDGNEAVASVAHRINEVIAIYPITPSSNMGEWADEWS
FT                   AKGQKNIWGTVPSVSEMQSEGGAAGAVHGALQAGALTTTFTASQGLLLMIPNMYKIAGE
FT                   LTAFCMHVSARSVATHALSIFGDHSDVMAVRQTGFGLLSSASVQEAHDFAAIAQRASML
FT                   SRVPFLHFFDGFRTSHEVAKMEELTDDDLRQMIPEELVAAHRSRALTPDKPTVRGTAQN
FT                   PDAFFQAREACNPFYAEAADHVQEAMDHFAKITGRRYKLFEYVGHPQAERVIVAMGSGC
FT                   DTIQETVEHLVAKGEKVGLVKVRLFRPFDLGAFMTAFPRTVHHIAVLDRTKEPGSLGEP
FT                   LYQDVVTALREAEQAHIDRFHHQLTVIGGRYGLSSKEFTPAMVKAVYDELSKARPKRHF
FT                   TVGINDDIGHTSLKYDPAFDTEPADVVRALFYGLGADGTVGANKNSIKIIGEDTPNFAQ
FT                   GYFVYDSKKSGSVTISHLRFGPRPIRSAYLISNANFVACHQFGFLEKYDMVEQAVPGST
FT                   FLLNSPYGPDEVWQHLPAEVQDQILQKKLKLYVIDAYKVARETGMGVRINTIMQTCFFA
FT                   ISGVLPKDEAIGHIKKTIEKTYARKGPEVVQKNFAAVDHTLAHLFEVSTAGRQVSGKPR
FT                   PPAVAEVAPDFVKRVTALMLAGKGDQLPVSAFPVDGTWPTGTSKWEKRSIALELPVWEP
FT                   SLCIQCNKCALICPHAAIRPKFFAPEALAAAPQGFVTMDFKSPDVKGNKYALQVSPDDC
FT                   TGCTLCVEICPAESKTEKGHKAINMKDAMPLKEKERTNWAFFLSIPEADRTRVKLDVKG
FT                   TQFLQPLFEFSGACTGCGETPYLKLLTQLYGDRAIIANATGCSSIFGANLPTTPYTQDE
FT                   AGRGPAWANSLFEDNAEFGFGMRLAIDKQAEHAKELLAKMGTVVGDGLVEEILKAEQGD
FT                   EAAIERQRARVKLLKQKLAAVDTFEARWLYKIADYLVRKSVWIVGGDGWAYDIGYGGLD
FT                   HVIAQGRDVNILVLDTEVYSNTGGQASKATPMGAAAKFATAGKSLPKKDLAMLAMTYGH
FT                   PYVARVALGAKDAQTVNAFKEADSYTGTSVIVAYAHCIAHGYEMSDALGQQEKAVESGY
FT                   WPLFRYDPRRVANGESPLKLDSPAPKIDLARFVENETRFRQVEASNPQGFAKMLEQAQK
FT                   DVRERYALYEQLARAMNPANLVPGAAAADGKPPKARA"
     MASRRMVTMD GNEAVASVAH RINEVIAIYP ITPSSNMGEW ADEWSAKGQK NIWGTVPSVS        60
     EMQSEGGAAG AVHGALQAGA LTTTFTASQG LLLMIPNMYK IAGELTAFCM HVSARSVATH       120
     ALSIFGDHSD VMAVRQTGFG LLSSASVQEA HDFAAIAQRA SMLSRVPFLH FFDGFRTSHE       180
     VAKMEELTDD DLRQMIPEEL VAAHRSRALT PDKPTVRGTA QNPDAFFQAR EACNPFYAEA       240
     ADHVQEAMDH FAKITGRRYK LFEYVGHPQA ERVIVAMGSG CDTIQETVEH LVAKGEKVGL       300
     VKVRLFRPFD LGAFMTAFPR TVHHIAVLDR TKEPGSLGEP LYQDVVTALR EAEQAHIDRF       360
     HHQLTVIGGR YGLSSKEFTP AMVKAVYDEL SKARPKRHFT VGINDDIGHT SLKYDPAFDT       420
     EPADVVRALF YGLGADGTVG ANKNSIKIIG EDTPNFAQGY FVYDSKKSGS VTISHLRFGP       480
     RPIRSAYLIS NANFVACHQF GFLEKYDMVE QAVPGSTFLL NSPYGPDEVW QHLPAEVQDQ       540
     ILQKKLKLYV IDAYKVARET GMGVRINTIM QTCFFAISGV LPKDEAIGHI KKTIEKTYAR       600
     KGPEVVQKNF AAVDHTLAHL FEVSTAGRQV SGKPRPPAVA EVAPDFVKRV TALMLAGKGD       660
     QLPVSAFPVD GTWPTGTSKW EKRSIALELP VWEPSLCIQC NKCALICPHA AIRPKFFAPE       720
     ALAAAPQGFV TMDFKSPDVK GNKYALQVSP DDCTGCTLCV EICPAESKTE KGHKAINMKD       780
     AMPLKEKERT NWAFFLSIPE ADRTRVKLDV KGTQFLQPLF EFSGACTGCG ETPYLKLLTQ       840
     LYGDRAIIAN ATGCSSIFGA NLPTTPYTQD EAGRGPAWAN SLFEDNAEFG FGMRLAIDKQ       900
     AEHAKELLAK MGTVVGDGLV EEILKAEQGD EAAIERQRAR VKLLKQKLAA VDTFEARWLY       960
     KIADYLVRKS VWIVGGDGWA YDIGYGGLDH VIAQGRDVNI LVLDTEVYSN TGGQASKATP      1020
     MGAAAKFATA GKSLPKKDLA MLAMTYGHPY VARVALGAKD AQTVNAFKEA DSYTGTSVIV      1080
     AYAHCIAHGY EMSDALGQQE KAVESGYWPL FRYDPRRVAN GESPLKLDSP APKIDLARFV      1140
     ENETRFRQVE ASNPQGFAKM LEQAQKDVRE RYALYEQLAR AMNPANLVPG AAAADGKPPK      1200
     ARA                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page