(data stored in ACNUC7421 zone)

EMBL: CP000769.PE239

CP000769.PE239       Location/Qualifiers
FT   CDS             279018..279524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0241"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_2405 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24459"
FT                   /db_xref="GOA:A7H6W3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W3"
FT                   /protein_id="ABS24459.1"
FT                   /translation="MTERKDRREFLKGLGIGAGVVALGGQSVAALRSLVPNVSYDAPTT
FT                   VKIGAPGEFPDGMKFLPEQRLFVFREGKVFHAISAVCTHLGCTVRAEALPRAETKTVEG
FT                   QPLKLTHRFLCPCHGSRYEGDGQNVAGPAPRPLDWYHLELALDDGQLVVDLAKPVDRDF
FT                   RLTIA"
     MTERKDRREF LKGLGIGAGV VALGGQSVAA LRSLVPNVSY DAPTTVKIGA PGEFPDGMKF        60
     LPEQRLFVFR EGKVFHAISA VCTHLGCTVR AEALPRAETK TVEGQPLKLT HRFLCPCHGS       120
     RYEGDGQNVA GPAPRPLDWY HLELALDDGQ LVVDLAKPVD RDFRLTIA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page