(data stored in ACNUC7421 zone)

EMBL: CP000769.PE24

CP000769.PE24        Location/Qualifiers
FT   CDS             complement(29495..29737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0024"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ade:Adeh_2436 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24244"
FT                   /db_xref="GOA:A7H698"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7H698"
FT                   /protein_id="ABS24244.1"
FT                   /translation="MSRRAYLTRSLHMPALADKFALNLKSERLRRKLSQEALATKARLS
FT                   VSYISMLERRQRTPPLETLECLAKALAVSPTSLLE"
     MSRRAYLTRS LHMPALADKF ALNLKSERLR RKLSQEALAT KARLSVSYIS MLERRQRTPP        60
     LETLECLAKA LAVSPTSLLE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page