(data stored in ACNUC7421 zone)

EMBL: CP000769.PE242

CP000769.PE242       Location/Qualifiers
FT   CDS             282133..284076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0244"
FT                   /product="Nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   ade:Adeh_2402 nitrous-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24462"
FT                   /db_xref="GOA:A7H6W6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W6"
FT                   /protein_id="ABS24462.1"
FT                   /translation="MSSSKSVSKPLAIAAVLVAAAAVAVRCAPREPKGARREAAKSDVS
FT                   VAAQKTYVAPGDLDEYYMFSSGGHSGQVFIYGLPSMRHLATIPVFAPYPATGYGFDDET
FT                   KEMLGKLTWGDVHHPALSETKGDYDGRWLFVNEMNGRIARIDLRDFKTRQIIGPVPNVS
FT                   GNHGSAFVTPNTEYAMMSSRFSIPIPKGTAVSIDKYASEYKGIVAGIKIDPESGKMSLG
FT                   WQVALPPFDWDLGDAGKLVSDGWMFLTCYNSERGTGKLEVTASQRDRDYIAAINWREAE
FT                   KAAAEGKGDLIGGVKVLDPRKVPGLVYLMPCGKSPHGVDVSPDGKYIIGSGKLQGVTTA
FT                   FNFEKVLTAIKNKDFTGEEDGIPVLKYESIKDAEVPVGLGPLHTQFGPDGWAYTSLFVD
FT                   SALAKWKLGTWEVVDKVPMSYSTGHLSAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQ
FT                   PESSQLVDISEDKMKLVYDAFTEPEPHYAQIIKADKVKPIEVYKKEENKNPLAVWDVKD
FT                   TGASRKGNEVVVKMTAVRSTFTPQLIEVNQGDTVKVAVTNIEQTTDELHGFGLLDYNIN
FT                   LVVDPGETKVVTFKADKPGVFPYYCTNFCSALHQEMQGYLVVRPARAAAPAEGDEGGGA
FT                   RAGREETRRGPR"
     MSSSKSVSKP LAIAAVLVAA AAVAVRCAPR EPKGARREAA KSDVSVAAQK TYVAPGDLDE        60
     YYMFSSGGHS GQVFIYGLPS MRHLATIPVF APYPATGYGF DDETKEMLGK LTWGDVHHPA       120
     LSETKGDYDG RWLFVNEMNG RIARIDLRDF KTRQIIGPVP NVSGNHGSAF VTPNTEYAMM       180
     SSRFSIPIPK GTAVSIDKYA SEYKGIVAGI KIDPESGKMS LGWQVALPPF DWDLGDAGKL       240
     VSDGWMFLTC YNSERGTGKL EVTASQRDRD YIAAINWREA EKAAAEGKGD LIGGVKVLDP       300
     RKVPGLVYLM PCGKSPHGVD VSPDGKYIIG SGKLQGVTTA FNFEKVLTAI KNKDFTGEED       360
     GIPVLKYESI KDAEVPVGLG PLHTQFGPDG WAYTSLFVDS ALAKWKLGTW EVVDKVPMSY       420
     STGHLSAAEG DTVSPDGKWL VGLNKLSHGR HLSVGPSQPE SSQLVDISED KMKLVYDAFT       480
     EPEPHYAQII KADKVKPIEV YKKEENKNPL AVWDVKDTGA SRKGNEVVVK MTAVRSTFTP       540
     QLIEVNQGDT VKVAVTNIEQ TTDELHGFGL LDYNINLVVD PGETKVVTFK ADKPGVFPYY       600
     CTNFCSALHQ EMQGYLVVRP ARAAAPAEGD EGGGARAGRE ETRRGPR                     647
//

If you have problems or comments...

PBIL Back to PBIL home page