(data stored in ACNUC7421 zone)

EMBL: CP000769.PE248

CP000769.PE248       Location/Qualifiers
FT   CDS             288437..289045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0250"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: ade:Adeh_0230 sigma-24
FT                   (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24468"
FT                   /db_xref="GOA:A7H6X2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X2"
FT                   /protein_id="ABS24468.1"
FT                   /translation="MAADESDERLMLRFQAGDARAFEALVGRHRTPVFSFLVRLTADRA
FT                   RAEDLCQEVFLKVVKASRTWEERARFRTWLYAIARNLAVDEARRAAFRRAEPLDAPGLA
FT                   GAAAYPAGDPAPDAAAEAALLRPKLEAALAALPDEQREVFLLREYAGLRFAEIADVTGT
FT                   PENTVKSRMRYALEGLREALAALGVGPEVPVSAAGGASP"
     MAADESDERL MLRFQAGDAR AFEALVGRHR TPVFSFLVRL TADRARAEDL CQEVFLKVVK        60
     ASRTWEERAR FRTWLYAIAR NLAVDEARRA AFRRAEPLDA PGLAGAAAYP AGDPAPDAAA       120
     EAALLRPKLE AALAALPDEQ REVFLLREYA GLRFAEIADV TGTPENTVKS RMRYALEGLR       180
     EALAALGVGP EVPVSAAGGA SP                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page