(data stored in ACNUC7421 zone)

EMBL: CP000769.PE251

CP000769.PE251       Location/Qualifiers
FT   CDS             291797..292897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0253"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /note="KEGG: ade:Adeh_0232 teichoic acid biosynthesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24471"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X5"
FT                   /protein_id="ABS24471.1"
FT                   /translation="MARILYGVAGEGMGHAIRSRVVIDHLSRSHDVQVVVSGRAHGYLK
FT                   ALERERLGVNRIWGLSIVYEDNEVRNFRTVLANVAGAALGGWPRNVKAYFDLALAFRPD
FT                   VVVSDFESWSHLFARMHGLRCLSVDNNQIVNRADHPPEITAGHEAEYLVAKAVVKAKLP
FT                   GCFHYLVATFFQPEAVKRRTTLHPPVLRPEILAARPEPGDHLLVYQTSTSNEALPDVLR
FT                   RSGRECRIYGLRRDLTSDERDGNLLWRPFDEPAFIEDLRTARAVVSGGSFTLMSEAVYL
FT                   HKPMLAVPVKRQFEQLLNARYLERLGYGAAAELIDDAVLAAFLGRLPELERRLAAYRQD
FT                   GNRDLLAKLGETIARALVPGDVGPLP"
     MARILYGVAG EGMGHAIRSR VVIDHLSRSH DVQVVVSGRA HGYLKALERE RLGVNRIWGL        60
     SIVYEDNEVR NFRTVLANVA GAALGGWPRN VKAYFDLALA FRPDVVVSDF ESWSHLFARM       120
     HGLRCLSVDN NQIVNRADHP PEITAGHEAE YLVAKAVVKA KLPGCFHYLV ATFFQPEAVK       180
     RRTTLHPPVL RPEILAARPE PGDHLLVYQT STSNEALPDV LRRSGRECRI YGLRRDLTSD       240
     ERDGNLLWRP FDEPAFIEDL RTARAVVSGG SFTLMSEAVY LHKPMLAVPV KRQFEQLLNA       300
     RYLERLGYGA AAELIDDAVL AAFLGRLPEL ERRLAAYRQD GNRDLLAKLG ETIARALVPG       360
     DVGPLP                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page