(data stored in ACNUC7421 zone)

EMBL: CP000769.PE253

CP000769.PE253       Location/Qualifiers
FT   CDS             293485..293886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24473"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X7"
FT                   /protein_id="ABS24473.1"
FT                   /translation="MRLAFVGAVALVLTACEIDDDCRTAREQHQPVQPIGVACTRGSYG
FT                   DCAEDYDDCAEGTCRHSDAAGGLICTVPCDAGCERHGLFCGTQGICEPAARCGLACSII
FT                   GYCCCTAGAPGLPTECGVLYCGWGLSSCG"
     MRLAFVGAVA LVLTACEIDD DCRTAREQHQ PVQPIGVACT RGSYGDCAED YDDCAEGTCR        60
     HSDAAGGLIC TVPCDAGCER HGLFCGTQGI CEPAARCGLA CSIIGYCCCT AGAPGLPTEC       120
     GVLYCGWGLS SCG                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page