(data stored in ACNUC7421 zone)

EMBL: CP000769.PE254

CP000769.PE254       Location/Qualifiers
FT   CDS             293951..294682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_1717 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24474"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X8"
FT                   /protein_id="ABS24474.1"
FT                   /translation="MSPWNVAQVATGRYLCHRARRGDQGSQEQAERVRPSRLAGGDGPH
FT                   RRSRPRRGGARPGRSAPERDGVRRGARRPRPPRRRDARAHAAGRPSRGASQDGAPRGAP
FT                   RGAGRRSRGPMIYLDTSVALAELFAEDRRAPDALWAEALVSSRLLEYELWTRIHARGAA
FT                   RTHDGPAREVLARVSFVELARPVLARALEPFPAPVRTLDALHLATVHYLAEAGQRVAVA
FT                   TFDARMAEAARRMSYPLAFAP"
     MSPWNVAQVA TGRYLCHRAR RGDQGSQEQA ERVRPSRLAG GDGPHRRSRP RRGGARPGRS        60
     APERDGVRRG ARRPRPPRRR DARAHAAGRP SRGASQDGAP RGAPRGAGRR SRGPMIYLDT       120
     SVALAELFAE DRRAPDALWA EALVSSRLLE YELWTRIHAR GAARTHDGPA REVLARVSFV       180
     ELARPVLARA LEPFPAPVRT LDALHLATVH YLAEAGQRVA VATFDARMAE AARRMSYPLA       240
     FAP                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page